Skip to main content

Advertisement

Table 1 Citrullinated peptides detected in collagen-induced arthritis joint tissue

From: Epitope spreading to citrullinated antigens in mouse models of autoimmune arthritis and demyelination

Protein name Accession number Total score Number of peptides % coverage cit peptide p value
Tropomyosin 1α [Genbank: 20522240] 1059 17 45 KLVIIESDLE(cit)AEER.A 0.039
Actin [Genbank: 51316973] 539 10 43 RTTGIVLDSGDGVTHNVPIYEGYALPHAIM(cit)L 0.04
Calgranulin-B [Genbank: 399173] 155 3 58 RSITTIIDTFHQYS(cit)K 0.1
ATP synthase β chain [Genbank: 20455479] 1441 21 66 KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLS(cit)A 0.012
      KSLQDIIAILGMDELSEEDKLTVS(cit)A 9.3e-08
      RIMNVIGEPIDE(cit)GPIKT 0.47